PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G02820.2
Common NameAtMYB88, MYB88
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 484aa    MW: 54507.6 Da    PI: 6.452
Description myb domain protein 88
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G02820.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.9e-133276348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd++l + + + G+++W+ Ia++++  ++  qc+ rw++yl
      AT2G02820.2 32 TWSPEEDDILRKQISLQGTENWAIIASKFN-DKSTRQCRRRWYTYL 76
                     6*****************************.*************97 PP

2Myb_DNA-binding44.73.1e-1482125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a +++G++ W+ Ia+ +  gRt++ +k+r+ +
      AT2G02820.2  82 RGGWSPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 125
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0012576IPR017930Myb domain
SuperFamilySSF466891.05E-2429123IPR009057Homeodomain-like
SMARTSM007172.0E-122978IPR001005SANT/Myb domain
CDDcd001671.10E-113276No hitNo description
PfamPF139211.6E-153393No hitNo description
Gene3DG3DSA:1.10.10.602.3E-193384IPR009057Homeodomain-like
PROSITE profilePS5129420.81277131IPR017930Myb domain
SMARTSM007178.4E-1581129IPR001005SANT/Myb domain
CDDcd001671.09E-1085126No hitNo description
Gene3DG3DSA:1.10.10.607.5E-1985130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MEETTKQNNM KKKKKILLHS DDSKKKERHI VTWSPEEDDI LRKQISLQGT ENWAIIASKF  60
NDKSTRQCRR RWYTYLNSDF KRGGWSPEED TLLCEAQRLF GNRWTEIAKV VSGRTDNAVK  120
NRFTTLCKKR AKHEAMAKEN RIACCVNSDN KRLLFPDGIS TPLKAESESP LTKKMRRSHI  180
PNLTEIKSYG DRSHIKVEST MNQQRRHPFS VVAHNATSSD GTEEQKQIGN VKESDGEDKS  240
NQEVFLKKDD SKVTALMQQA ELLSSLAQKV NADNTDQSME NAWKVLQDFL NKSKENDLFR  300
YGIPDIDFQL DEFKDLVEDL RSSNEDSQSS WRQPDLHDSP ASSEYSSGSG SGSTIMTHPS  360
GDKTQQLMSD TQTTSHQQNG GELLQDNGIV SDATVEQVGL LSTGHDVLKN SNETVPIPGE  420
EEFNSPVQVT PLFRSLAAGI PSPQFSESER NFLLKTLGVE SPSPYPSANP SQPPPCKRVL  480
LDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-243313110108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.115760.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267485_at0.0
Expression AtlasAT2G02820-
AtGenExpressAT2G02820-
ATTED-IIAT2G02820-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB88), involved in stomata development, double loss of MYB88 and FLP (MYB124) activity results in a failure of guard mother cells (GMCs) to adopt the guard cell fate, thus they continue to divide resulting in abnormal stomata consisting of clusters of numerous guard cell-like cells. This phenotype is enhanced in double mutants over the single mutant flp phenotype.
Function -- GeneRIF ? help Back to Top
  1. flp-1 myb88 double mutant plants show enhanced sensitivity to drought and salt stress.
    [PMID: 21105921]
  2. FLP and MYB88 are important regulators of entry into megasporogenesis, and probably act via the regulation of cell cycle genes.
    [PMID: 22915737]
  3. FLP and MYB88 restrict the G1/S transition during stomatal formation.
    [PMID: 24123248]
  4. Both flp and myb88 genes were expressed in many, previously unreported locations, consistent with the possibility of additional functions for FLP and MYB88. Moreover, expression domains especially of FLP display sharp cutoffs or boundaries.
    [PMID: 26391711]
  5. FLP and MYB88 expression specifically determines the temporal-spatial patterns of PIN3 and PIN7 transcription that are closely associated with their preferential functions during root responses to gravity.
    [PMID: 26578169]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G02820.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G50410 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G02820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2265750.0AK226575.1 Arabidopsis thaliana mRNA for hypothetical protein, clone: RAFL07-13-I18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001030957.10.0myb domain protein 88
TrEMBLF4IRB40.0F4IRB4_ARATH; Myb domain protein 88
STRINGAT2G02820.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Representative plantOGRP54161421
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Lai LB, et al.
    The Arabidopsis R2R3 MYB proteins FOUR LIPS and MYB88 restrict divisions late in the stomatal cell lineage.
    Plant Cell, 2005. 17(10): p. 2754-67
    [PMID:16155180]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Diet A, et al.
    The Arabidopsis root hair cell wall formation mutant lrx1 is suppressed by mutations in the RHM1 gene encoding a UDP-L-rhamnose synthase.
    Plant Cell, 2006. 18(7): p. 1630-41
    [PMID:16766693]
  7. Ohashi-Ito K,Bergmann DC
    Arabidopsis FAMA controls the final proliferation/differentiation switch during stomatal development.
    Plant Cell, 2006. 18(10): p. 2493-505
    [PMID:17088607]
  8. Skirycz A, et al.
    The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana.
    Plant J., 2008. 56(5): p. 779-92
    [PMID:18665917]
  9. Xie Z,Li D,Wang L,Sack FD,Grotewold E
    Role of the stomatal development regulators FLP/MYB88 in abiotic stress responses.
    Plant J., 2010. 64(5): p. 731-9
    [PMID:21105921]
  10. Vanneste S, et al.
    Developmental regulation of CYCA2s contributes to tissue-specific proliferation in Arabidopsis.
    EMBO J., 2011. 30(16): p. 3430-41
    [PMID:21772250]
  11. Makkena S,Lee E,Sack FD,Lamb RS
    The R2R3 MYB transcription factors FOUR LIPS and MYB88 regulate female reproductive development.
    J. Exp. Bot., 2012. 63(15): p. 5545-58
    [PMID:22915737]
  12. Lee E,Liu X,Eglit Y,Sack F
    FOUR LIPS and MYB88 conditionally restrict the G1/S transition during stomatal formation.
    J. Exp. Bot., 2013. 64(16): p. 5207-19
    [PMID:24123248]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  14. Lei Q, et al.
    The FOUR LIPS and MYB88 transcription factor genes are widely expressed in Arabidopsis thaliana during development.
    Am. J. Bot., 2015. 102(9): p. 1521-8
    [PMID:26391711]
  15. Wang HZ, et al.
    Transcriptional regulation of PIN genes by FOUR LIPS and MYB88 during Arabidopsis root gravitropism.
    Nat Commun, 2015. 6: p. 8822
    [PMID:26578169]
  16. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]